Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

H6PD polyclonal antibody

  • Catalog # : PAB31295
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human H6PD.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 43-154 of human H6PD.
  • Sequence:
  • WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) human cell line RT-4 (2) human cell line U-251MG sp (3) human plasma (IgG/HSA depleted) (4) human liver tissue, and (5) human tonsil tissue.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9563
  • Gene Name:
  • H6PD
  • Gene Alias:
  • DKFZp686A01246,G6PDH,GDH,MGC87643
  • Gene Description:
  • hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
  • Gene Summary:
  • There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. [provided by RefSeq
  • Other Designations:
  • 6-phosphogluconolactonase,G6PD, H form,GDH/6PGL endoplasmic bifunctional protein,OTTHUMP00000001703,glucose 1- dehydrogenase,glucose dehydrogenase,glucose dehyrogenase,glucose-6-phosphate dehydrogenase, salivary,hexose-6-phosphate dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook