H6PD polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human H6PD.
Immunogen
Recombinant protein corresponding to amino acids 43-154 of human H6PD.
Sequence
WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).Western Blot
Western Blot analysis of (1) human cell line RT-4 (2) human cell line U-251MG sp (3) human plasma (IgG/HSA depleted) (4) human liver tissue, and (5) human tonsil tissue.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver shows strong cytoplasmic positivity in hepatocytes. -
Gene Info — H6PD
Entrez GeneID
9563Protein Accession#
O95479Gene Name
H6PD
Gene Alias
DKFZp686A01246, G6PDH, GDH, MGC87643
Gene Description
hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Gene Ontology
HyperlinkGene Summary
There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. [provided by RefSeq
Other Designations
6-phosphogluconolactonase|G6PD, H form|GDH/6PGL endoplasmic bifunctional protein|OTTHUMP00000001703|glucose 1- dehydrogenase|glucose dehydrogenase|glucose dehyrogenase|glucose-6-phosphate dehydrogenase, salivary|hexose-6-phosphate dehydrogenase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM.
Proteome Science 2011 Nov; 9:73.
Application:Array, Recombinant protein.
-
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com