AXL polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with AXL polyclonal antibody (Cat # PAB31203) shows strong cytoplasmic positivity in cells in seminiferous ducts.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human AXL.
Immunogen
Recombinant protein corresponding to human AXL.
Sequence
PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with AXL polyclonal antibody (Cat # PAB31203) shows strong cytoplasmic positivity in cells in seminiferous ducts. -
Gene Info — AXL
Entrez GeneID
558Protein Accession#
P30530Gene Name
AXL
Gene Alias
JTK11, UFO
Gene Description
AXL receptor tyrosine kinase
Omim ID
109135Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
AXL transforming sequence/gene|oncogene AXL
-
Interactome
-
Disease
-
Publication Reference
-
The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers.
Ong CW, Chong PY, McArt DG, Chan JY, Tan HT, Kumar AP, Chung MC, Clement MV, Soong R, Van Schaeybroeck S, Waugh DJ, Johnston PG, Dunne PD, Salto-Tellez M.
Oncotarge 2015 May; 6(14):12763.
Application：IHC-P, Human, Human colorectal cancer.
-
The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma.
Pinato DJ, Mauri FA, Lloyd T, Vaira V, Casadio C, Boldorini RL, Sharma R.
British Journal of Cancer 2013 Feb; 108(3):621.
Application：IHC-P, Human, Human malignant pleural mesothelioma.
-
The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com