TENC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with TENC1 polyclonal antibody (Cat # PAB31181) shows moderate cytoplasmic positivity in hepatocytes.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TENC1.
Immunogen
Recombinant protein corresponding to human TENC1.
Sequence
VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with TENC1 polyclonal antibody (Cat # PAB31181) shows moderate cytoplasmic positivity in hepatocytes. -
Gene Info — TENC1
Entrez GeneID
23371Protein Accession#
Q63HR2Gene Name
TENC1
Gene Alias
C1-TEN, C1TEN, DKFZp686D13244, FLJ16320, KIAA1075, TNS2
Gene Description
tensin like C1 domain containing phosphatase (tensin 2)
Omim ID
607717Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the tensin family. Tensin is a focal adhesion molecule that binds to actin filaments and participates in signaling pathways. This protein plays a role in regulating cell migration. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq
Other Designations
tensin 2|tensin like C1 domain containing phosphatase|tensin like C1 domain-containing phosphatase
-
Interactome
-
Publication Reference
-
Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF-A and TGFβ2 in vascular abnormalization.
Dieterich LC, Mellberg S, Langenkamp E, Zhang L, Zieba A, Salomäki H, Teichert M, Huang H, Edqvist PH, Kraus T, Augustin HG, Olofsson T, Larsson E, Söderberg O, Molema G, Pontén F, Georgii-Hemming P, Alafuzoff I, Dimberg A.
The Journal of Pathology 2012 Nov; 228(3):378.
Application：IHC-P, Human, Human brain tumour tissue microarray.
-
Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF-A and TGFβ2 in vascular abnormalization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com