Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KIF2A polyclonal antibody

  • Catalog # : PAB31125
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human KIF2A.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 35-144 of human KIF2A.
  • Sequence:
  • DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of (1) human cell line RT-4, and (2) human cell line U-251MG sp.
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis shows nuclear positivity in cells of seminiferus ducts.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3796
  • Gene Name:
  • KIF2A
  • Gene Alias:
  • HK2,KIF2
  • Gene Description:
  • kinesin heavy chain member 2A
  • Gene Summary:
  • Kinesins, such as KIF2, are microtubule-associated motor proteins. For background information on kinesins, see MIM 148760.[supplied by OMIM
  • Other Designations:
  • Kinesin, heavy chain, 2,kinesin heavy chain member 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook