Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FZD7 polyclonal antibody

  • Catalog # : PAB31107
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human FZD7.
  • Immunogen:
  • Recombinant protein corresponding to human FZD7.
  • Sequence:
  • CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of CACO-2 cell line with antibody shows positivity in nucleoplasma (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 8324
  • Gene Name:
  • FZD7
  • Gene Alias:
  • FzE3
  • Gene Description:
  • frizzled homolog 7 (Drosophila)
  • Gene Summary:
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq
  • Other Designations:
  • Frizzled, drosophila, homolog of, 7,frizzled 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook