Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF11 polyclonal antibody

  • Catalog # : PAB31106
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human FGF11.
  • Immunogen:
  • Recombinant protein corresponding to human FGF11.
  • Sequence:
  • VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HaCaT cell line with antibody shows positivity in centrosome (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 2256
  • Gene Name:
  • FGF11
  • Gene Alias:
  • FHF3,FLJ16061,MGC102953,MGC45269
  • Gene Description:
  • fibroblast growth factor 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development. [provided by RefSeq
  • Other Designations:
  • fibroblast growth factor homologous factor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook