Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIK3CB polyclonal antibody

  • Catalog # : PAB31105
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human PIK3CB.
  • Immunogen:
  • Recombinant protein corresponding to human PIK3CB.
  • Sequence:
  • LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:500-1000)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG cell, (3) Human plasma.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of SK-MEL-30 cell line with antibody shows positivity in nucleoplasma (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 5291
  • Gene Name:
  • PIK3CB
  • Gene Alias:
  • DKFZp779K1237,MGC133043,PI3K,PI3KCB,PI3Kbeta,PIK3C1,p110-BETA
  • Gene Description:
  • phosphoinositide-3-kinase, catalytic, beta polypeptide
  • Gene Summary:
  • Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM
  • Other Designations:
  • PI3-kinase p110 subunit beta,PtdIns-3-kinase p110,phosphatidylinositol 3-kinase, catalytic, beta polypeptide
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook