Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KRAS polyclonal antibody

  • Catalog # : PAB31099
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human KRAS.
  • Immunogen:
  • Recombinant protein corresponding to human KRAS.
  • Sequence:
  • EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3845
  • Gene Name:
  • KRAS
  • Gene Alias:
  • C-K-RAS,K-RAS2A,K-RAS2B,K-RAS4A,K-RAS4B,KI-RAS,KRAS1,KRAS2,NS3,RASK2
  • Gene Description:
  • v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
  • Gene Summary:
  • This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq
  • Other Designations:
  • K-ras p21 protein,Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog,PR310 c-K-ras oncogene,c-K-ras2 protein,c-Kirsten-ras protein,cellular c-Ki-ras2 proto-oncogene,oncogene KRAS2,transforming protein p21,v-Ki-ras2 Kirsten rat sarcoma 2 viral oncoge
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook