Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRB2 polyclonal antibody

  • Catalog # : PAB31095
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human GRB2.
  • Immunogen:
  • Recombinant protein corresponding to human GRB2.
  • Sequence:
  • KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-250)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG cell, (3) Human plasma, (4) Human liver tissue, (5) Human tonsil tissue.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of PC-3 cell line with antibody shows positivity in nucleus and nucleoli (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 2885
  • Gene Name:
  • GRB2
  • Gene Alias:
  • ASH,EGFRBP-GRB2,Grb3-3,MST084,MSTP084
  • Gene Description:
  • growth factor receptor-bound protein 2
  • Gene Summary:
  • The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HT027,OTTHUMP00000166096,OTTHUMP00000166097,OTTHUMP00000166098,abundant SRC homology,epidermal growth factor receptor-binding protein GRB2,growth factor receptor-bound protein 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook