Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DVL2 polyclonal antibody

  • Catalog # : PAB31094
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human DVL2.
  • Immunogen:
  • Recombinant protein corresponding to human DVL2.
  • Sequence:
  • PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-250)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG sp cell.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of SH-SY5Y cell line with antibody shows positivity in nucleoplasma (green).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1856
  • Gene Name:
  • DVL2
  • Gene Alias:
  • -
  • Gene Description:
  • dishevelled, dsh homolog 2 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans. [provided by RefSeq
  • Other Designations:
  • DSH homolog 2,dishevelled 2,dishevelled 2 (homologous to Drosophila dsh),segment polarity protein dishevelled homolog DVL-2
  • RSS
  • YouTube
  • Linkedin
  • Facebook