Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK4 polyclonal antibody

  • Catalog # : PAB31092
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human CDK4.
  • Immunogen:
  • Recombinant protein corresponding to human CDK4.
  • Sequence:
  • KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of MCF7 cell line with antibody shows positivity in nucleus, nucleoli, nuclear membrane and cytosol (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 1019
  • Gene Name:
  • CDK4
  • Gene Alias:
  • CMM3,MGC14458,PSK-J3
  • Gene Description:
  • cyclin-dependent kinase 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq
  • Other Designations:
  • cell division kinase 4,melanoma cutaneous malignant, 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook