NDUFB5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG cell, (3) Human plasma (IgG/HSA depleted), (4) Human liver tissue, (5) Human tonsil tissue.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-2 OS cell line with antibody shows positivity in nucleoplasm and mitochondria (green).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human NDUFB5.
Immunogen
Recombinant protein corresponding to human NDUFB5.
Sequence
EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG cell, (3) Human plasma (IgG/HSA depleted), (4) Human liver tissue, (5) Human tonsil tissue.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-2 OS cell line with antibody shows positivity in nucleoplasm and mitochondria (green). -
Gene Info — NDUFB5
Entrez GeneID
4711Protein Accession#
O43674Gene Name
NDUFB5
Gene Alias
CI-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, SGDH
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Omim ID
603841Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5 (16kD, SGDH)|NADH-ubiquinone oxidoreductase SGDH subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
p16(Ink4a)-induced senescence of pancreatic beta cells enhances insulin secretion.
Aharon Helman, Agnes Klochendler, Narmen Azazmeh, Yael Gabai, Elad Horwitz, Shira Anzi, Avital Swisa, Reba Condiotti, Roy Z Granit, Yuval Nevo, Yaakov Fixler, Dorin Shreibman, Amit Zamir, Sharona Tornovsky-Babeay, Chunhua Dai, Benjamin Glaser, Alvin C Powers, A M James Shapiro, Mark A Magnuson, Yuval Dor, Ittai Ben-Porath.
Nature Medicine 2016 Apr; 22(4):412.
Application：IF, IHC-P, Human, Human islets.
-
p16(Ink4a)-induced senescence of pancreatic beta cells enhances insulin secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com