Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FRMD8 polyclonal antibody

  • Catalog # : PAB31072
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human FRMD8.
  • Immunogen:
  • Recombinant protein corresponding to human FRMD8.
  • Sequence:
  • SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Western Blot (1:100-250)
    Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG cell, (3) Human plasma, (4) Human liver tissue, (5) Human tonsil tissue.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251MG cell line with antibody shows positivity in nucleus, nucleoli and cytosol (green).
  • Application Image
  • Gene Information
  • Gene Name:
  • FRMD8
  • Gene Alias:
  • FKSG44,FLJ32216,FLJ90369,MGC31785
  • Gene Description:
  • FERM domain containing 8
  • Other Designations:
  • FKSG44
  • RSS
  • YouTube
  • Linkedin
  • Facebook