Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPS6KB2 polyclonal antibody

  • Catalog # : PAB31063
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human RPS6KB2.
  • Immunogen:
  • Recombinant protein corresponding to human RPS6KB2.
  • Sequence:
  • VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
    Western Blot (1:100-250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6199
  • Gene Name:
  • RPS6KB2
  • Gene Alias:
  • KLS,P70-beta,P70-beta-1,P70-beta-2,S6K-beta2,S6K2,SRK,STK14B,p70(S6K)-beta,p70S6Kb
  • Gene Description:
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • Gene Summary:
  • This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq
  • Other Designations:
  • S6 kinase-related kinase,p70 ribosomal S6 kinase beta,ribosomal protein S6 kinase, 70kD, polypeptide 2,serine/threonine-protein kinase 14 beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook