Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCC polyclonal antibody

  • Catalog # : PAB31060
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human DCC.
  • Immunogen:
  • Recombinant protein corresponding to human DCC.
  • Sequence:
  • GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of AF22 cell line with antibody shows positivity in Golgi apparatus (green).
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 1630
  • Gene Name:
  • DCC
  • Gene Alias:
  • CRC18,CRCR1,IGDCC1
  • Gene Description:
  • deleted in colorectal carcinoma
  • Other Designations:
  • deleted in colorectal cancer protein,immunoglobulin superfamily, DCC subclass, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook