Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PDGFD polyclonal antibody

  • Catalog # : PAB31056
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human PDGFD.
  • Immunogen:
  • Recombinant protein corresponding to human PDGFD.
  • Sequence:
  • ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-431 cell line with antibody shows positivity in vesicles (green).
  • Application Image
  • Gene Information
  • Gene Name:
  • PDGFD
  • Gene Alias:
  • IEGF,MGC26867,MSTP036,SCDGF-B,SCDGFB
  • Gene Description:
  • platelet derived growth factor D
  • Gene Summary:
  • The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are found in this factor. This gene product only forms homodimers and, therefore, does not dimerize with the other three family members. It differs from alpha and beta members of this family in having an unusual N-terminal domain, the CUB domain. Two splice variants have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • iris-expressed growth factor,spinal cord derived growth factor B,spinal cord-derived growth factor-B
  • RSS
  • YouTube
  • Linkedin
  • Facebook