Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB8 polyclonal antibody

  • Catalog # : PAB31019
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombiant human NDUFB8.
  • Immunogen:
  • Recombinant protein corresponding to human NDUFB8.
  • Sequence:
  • GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
    Western Blot (1:100-250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of (1) Human RT-4 cell, (2) Human U-251MG sp cell.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle shows strong granular positivity in myocytes.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4714
  • Gene Name:
  • NDUFB8
  • Gene Alias:
  • ASHI,CI-ASHI
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 (8kD, AGGG),NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI),NADH:ubiquinone oxidoreductase ASHI subunit,OTTHUMP00000020835,OTTHUMP00000059404
  • RSS
  • YouTube
  • Linkedin
  • Facebook