Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UPK3A polyclonal antibody

  • Catalog # : PAB30901
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human UPK3A.
  • Immunogen:
  • Recombinant protein corresponding to human UPK3A.
  • Sequence:
  • TFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with UPK3A polyclonal antibody (Cat # PAB30901) shows strong cytoplasmic and membranous positivity in urothelial cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7380
  • Gene Name:
  • UPK3A
  • Gene Alias:
  • MGC119178,UPIII,UPIIIA,UPK3
  • Gene Description:
  • uroplakin 3A
  • Gene Summary:
  • Uroplakins (UPK) are integral membrane proteins that form 2-dimensional crystalline arrays termed urothelial plaques that cover more than 90% of the apical urothelial surface. The asymmetric unit membrane (AUM) forms the apical plaques of urothelium and is believed to strengthen the urothelial apical surface and prevent the cells from rupturing during bladder distention. The 4 major conserved integral membrane proteins of the AUM are UPK1A (MIM 611557), UPK1B (MIM 602380), UPK2 (MIM 611558), and UPK3A.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000028951,uroplakin III
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook