Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGAT3 polyclonal antibody

  • Catalog # : PAB30892
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human MGAT3.
  • Immunogen:
  • Recombinant protein corresponding to human MGAT3.
  • Sequence:
  • RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with MGAT3 polyclonal antibody (Cat # PAB30892) shows strong cytoplasmic positivity in myocytes.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4248
  • Gene Name:
  • MGAT3
  • Gene Alias:
  • FLJ43371,GNT-III,GNT3,MGC141943,MGC142278
  • Gene Description:
  • mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • Gene Summary:
  • There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • GlcNAc-T III,N-acetylglucosaminyltransferase III,N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III,OTTHUMP00000028574,OTTHUMP00000042207,beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook