Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NR5A2 polyclonal antibody

  • Catalog # : PAB30886
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human NR5A2.
  • Immunogen:
  • Recombinant protein corresponding to human NR5A2.
  • Sequence:
  • RQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with NR5A2 polyclonal antibody (Cat # PAB30886) shows strong nuclear positivity in tubular cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2494
  • Gene Name:
  • NR5A2
  • Gene Alias:
  • B1F,B1F2,CPF,FTF,FTZ-F1,FTZ-F1beta,LRH-1,hB1F,hB1F-2
  • Gene Description:
  • nuclear receptor subfamily 5, group A, member 2
  • Other Designations:
  • CYP7A promoter-binding factor,OTTHUMP00000033644,OTTHUMP00000033646,b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus,fetoprotein-alpha 1 (AFP) transcription factor,liver receptor homolog 1,liver receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook