Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHPT1 polyclonal antibody

  • Catalog # : PAB30810
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human PHPT1.
  • Immunogen:
  • Recombinant protein corresponding to human PHPT1.
  • Sequence:
  • DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with PHPT1 polyclonal antibody (Cat # PAB30810) shows strong cytoplasmic positivity of mucus in the goblet cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG with PHPT1 polyclonal antibody (Cat # PAB30810) (Green) shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PHPT1
  • Gene Alias:
  • CGI-202,DKFZp564M173,HSPC141,PHP14,bA216L13.10
  • Gene Description:
  • phosphohistidine phosphatase 1
  • Gene Summary:
  • PHPT1 is an EDTA-insensitive phosphohistidine phosphatase that catalyzes the dephosphorylation of phosphopeptide I (Ek et al., 2002 [PubMed 12383260]).[supplied by OMIM
  • Other Designations:
  • 1700008C22Rik,OTTHUMP00000022619,phosphohistidine phosphatase 14kDa,sex-regulated protein janus-a
  • RSS
  • YouTube
  • Linkedin
  • Facebook