DUSP8 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with DUSP8 polyclonal antibody (Cat # PAB30807) shows strong positivity in glial cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with DUSP8 polyclonal antibody (Cat # PAB30807) (Green) shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DUSP8.
Immunogen
Recombinant protein corresponding to human DUSP8.
Sequence
SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with DUSP8 polyclonal antibody (Cat # PAB30807) shows strong positivity in glial cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with DUSP8 polyclonal antibody (Cat # PAB30807) (Green) shows positivity in cytoplasm. -
Gene Info — DUSP8
Entrez GeneID
1850Protein Accession#
Q13202Gene Name
DUSP8
Gene Alias
C11orf81, FLJ42476, FLJ42958, HB5, HVH-5, HVH8
Gene Description
dual specificity phosphatase 8
Omim ID
602038Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates SAPK/JNK and p38, is expressed predominantly in the adult brain, heart, and skeletal muscle, is localized in the cytoplasm, and is induced by nerve growth factor and insulin. An intronless pseudogene for DUSP8 is present on chromosome 10q11.2. [provided by RefSeq
Other Designations
H1 phosphatase, vaccinia virus homolog|serine/threonine specific protein phosphatase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com