Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYNE1 polyclonal antibody

  • Catalog # : PAB30804
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human SYNE1.
  • Immunogen:
  • Recombinant protein corresponding to human SYNE1.
  • Sequence:
  • SRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWEL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with SYNE1 polyclonal antibody (Cat # PAB30804) shows strong cytoplasmic and nuclear membranous positivity in myocytes.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG with SYNE1 polyclonal antibody (Cat # PAB30804) (Green) shows positivity in nuclear membrane and nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • SYNE1
  • Gene Alias:
  • 8B,CPG2,DKFZp781J13156,FLJ30878,FLJ41140,KIAA0796,KIAA1262,KIAA1756,MYNE1,SCAR8
  • Gene Description:
  • spectrin repeat containing, nuclear envelope 1
  • Gene Summary:
  • This gene encodes a spectrin repeat containing protein expressed in skeletal and smooth muscle, and peripheral blood lymphocytes, that localizes to the nuclear membrane. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia 8, also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017437,OTTHUMP00000017438,enaptin,nesprin 1,nuclear envelope spectrin repeat protein 1,synaptic nuclei expressed gene 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook