YWHAE polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with YWHAE polyclonal antibody (Cat # PAB30801).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with YWHAE polyclonal antibody (Cat # PAB30801) shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with YWHAE polyclonal antibody (Cat # PAB30801) (Green) shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human YWHAE.
Immunogen
Recombinant protein corresponding to human YWHAE.
Sequence
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with YWHAE polyclonal antibody (Cat # PAB30801).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with YWHAE polyclonal antibody (Cat # PAB30801) shows strong cytoplasmic and nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with YWHAE polyclonal antibody (Cat # PAB30801) (Green) shows positivity in cytoplasm. -
Gene Info — YWHAE
Entrez GeneID
7531Protein Accession#
P62258Gene Name
YWHAE
Gene Alias
14-3-3E, FLJ45465, KCIP-1, MDCR, MDS
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq
Other Designations
14-3-3 epsilon|mitochondrial import stimulation factor L subunit|protein kinase C inhibitor protein-1|tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com