ARPC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ARPC2 polyclonal antibody (Cat # PAB30798).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with ARPC2 polyclonal antibody (Cat # PAB30798) shows strong cytoplasmic positivity in reaction center cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with ARPC2 polyclonal antibody (Cat # PAB30798) (Green) shows positivity in cytoplasm and the Golgi apparatus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ARPC2.
Immunogen
Recombinant protein corresponding to human ARPC2.
Sequence
TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ARPC2 polyclonal antibody (Cat # PAB30798).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with ARPC2 polyclonal antibody (Cat # PAB30798) shows strong cytoplasmic positivity in reaction center cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with ARPC2 polyclonal antibody (Cat # PAB30798) (Green) shows positivity in cytoplasm and the Golgi apparatus. -
Gene Info — ARPC2
Entrez GeneID
10109Protein Accession#
O15144Gene Name
ARPC2
Gene Alias
ARC34, PNAS-139, PRO2446, p34-Arc
Gene Description
actin related protein 2/3 complex, subunit 2, 34kDa
Omim ID
604224Gene Ontology
HyperlinkGene Summary
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq
Other Designations
ARP2/3 protein complex subunit 34|OTTHUMP00000164144|actin related protein 2/3 complex subunit 2|actin related protein 2/3 complex, subunit 2 (34 kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com