Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

INA polyclonal antibody

  • Catalog # : PAB30792
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human INA.
  • Immunogen:
  • Recombinant protein corresponding to human INA.
  • Sequence:
  • ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of mouse cerebral cortex tissue lysate with INA polyclonal antibody (Cat # PAB30792).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with INA polyclonal antibody (Cat # PAB30792).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human cerebellum (C) with INA polyclonal antibody (Cat # PAB30792). A: Human hippocampus shows distinct positivity in neuronal processes. B: Human hippocampus shows strong positivity in neuropil. C: Human cerebellum shows strong cytoplasmic positivity in purkinje cells and neuropil.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A549 (A), mouse dentate gyrus (B), mouse olfactory bulb (C), mouse dorsal tenia tecta (D) and mouse medulla (E) with INA polyclonal antibody (Cat # PAB30792) (Green). A: A549 shows positivity in nuclear membrane, intermediate filaments and nucleus but excluded from the nucleoli. B: Mouse dentate gyrus shows selective immunoreactivity in a subset of granular cells and their dendrites. C: Mouse olfactory bulb shows strong positivity in neuronal processes and some cell bodies in the external plexiform layer. D: Mouse dorsal tenia tecta shows selective immunoreactivity in a subset of neurons. E: Mouse medulla shows distinct staining of nerve bundles.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9118
  • Gene Name:
  • INA
  • Gene Alias:
  • FLJ18662,FLJ57501,MGC12702,NEF5,NF-66,TXBP-1
  • Gene Description:
  • internexin neuronal intermediate filament protein, alpha
  • Gene Summary:
  • Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020403,neurofilament 5 (66kD),neurofilament-66, tax-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook