INA polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of mouse cerebral cortex tissue lysate with INA polyclonal antibody (Cat # PAB30792).
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with INA polyclonal antibody (Cat # PAB30792).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human cerebellum (C) with INA polyclonal antibody (Cat # PAB30792). A: Human hippocampus shows distinct positivity in neuronal processes. B: Human hippocampus shows strong positivity in neuropil. C: Human cerebellum shows strong cytoplasmic positivity in purkinje cells and neuropil.
Immunofluorescence
Immunofluorescent staining of A549 (A), mouse dentate gyrus (B), mouse olfactory bulb (C), mouse dorsal tenia tecta (D) and mouse medulla (E) with INA polyclonal antibody (Cat # PAB30792) (Green). A: A549 shows positivity in nuclear membrane, intermediate filaments and nucleus but excluded from the nucleoli. B: Mouse dentate gyrus shows selective immunoreactivity in a subset of granular cells and their dendrites. C: Mouse olfactory bulb shows strong positivity in neuronal processes and some cell bodies in the external plexiform layer. D: Mouse dorsal tenia tecta shows selective immunoreactivity in a subset of neurons. E: Mouse medulla shows distinct staining of nerve bundles.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human INA.
Immunogen
Recombinant protein corresponding to human INA.
Sequence
ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of mouse cerebral cortex tissue lysate with INA polyclonal antibody (Cat # PAB30792).Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with INA polyclonal antibody (Cat # PAB30792).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human cerebellum (C) with INA polyclonal antibody (Cat # PAB30792). A: Human hippocampus shows distinct positivity in neuronal processes. B: Human hippocampus shows strong positivity in neuropil. C: Human cerebellum shows strong cytoplasmic positivity in purkinje cells and neuropil.Immunofluorescence
Immunofluorescent staining of A549 (A), mouse dentate gyrus (B), mouse olfactory bulb (C), mouse dorsal tenia tecta (D) and mouse medulla (E) with INA polyclonal antibody (Cat # PAB30792) (Green). A: A549 shows positivity in nuclear membrane, intermediate filaments and nucleus but excluded from the nucleoli. B: Mouse dentate gyrus shows selective immunoreactivity in a subset of granular cells and their dendrites. C: Mouse olfactory bulb shows strong positivity in neuronal processes and some cell bodies in the external plexiform layer. D: Mouse dorsal tenia tecta shows selective immunoreactivity in a subset of neurons. E: Mouse medulla shows distinct staining of nerve bundles. -
Gene Info — INA
Entrez GeneID
9118Protein Accession#
Q16352Gene Name
INA
Gene Alias
FLJ18662, FLJ57501, MGC12702, NEF5, NF-66, TXBP-1
Gene Description
internexin neuronal intermediate filament protein, alpha
Omim ID
605338Gene Ontology
HyperlinkGene Summary
Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. [provided by RefSeq
Other Designations
OTTHUMP00000020403|neurofilament 5 (66kD)|neurofilament-66, tax-binding protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com