Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PNCK polyclonal antibody

  • Catalog # : PAB30780
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human PNCK.
  • Immunogen:
  • Recombinant protein corresponding to human PNCK.
  • Sequence:
  • MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus with PNCK polyclonal antibody (Cat # PAB30780) shows moderate cytoplasmic positivity in neuronal cells, glial cells showed moderate cytoplasmic and nuclear staining.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG with PNCK polyclonal antibody (Cat # PAB30780) (Green) shows positivity in plasma membrane and cytoplasm.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PNCK
  • Gene Alias:
  • BSTK3,CaMK1b,FLJ50403,FLJ50549,FLJ56451,FLJ59811,MGC45419
  • Gene Description:
  • pregnancy up-regulated non-ubiquitously expressed CaM kinase
  • Gene Summary:
  • PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000025964,pregnancy upregulated non-ubiquitously expressed CaM kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook