Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NQO1 polyclonal antibody

  • Catalog # : PAB30779
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human NQO1.
  • Immunogen:
  • Recombinant protein corresponding to human NQO1.
  • Sequence:
  • FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with NQO1 polyclonal antibody (Cat # PAB30779).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with NQO1 polyclonal antibody (Cat # PAB30779) shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS with NQO1 polyclonal antibody (Cat # PAB30779) (Green) shows positivity in cytoplasm.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1728
  • Gene Name:
  • NQO1
  • Gene Alias:
  • DHQU,DIA4,DTD,NMOR1,NMORI,QR1
  • Gene Description:
  • NAD(P)H dehydrogenase, quinone 1
  • Gene Summary:
  • This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • DT-diaphorase,NAD(P)H menadione oxidoreductase 1, dioxin-inducible,NAD(P)H:Quinone acceptor oxidoreductase type 1,NAD(P)H:menadione oxidoreductase 1,NAD(P)H:quinone oxireductase,azoreductase,diaphorase (NADH/NADPH) (cytochrome b-5 reductase),diaphorase-4,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook