AK1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with AK1 polyclonal antibody (Cat # PAB30760).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human thyroid gland with AK1 polyclonal antibody (Cat # PAB30760) shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with AK1 polyclonal antibody (Cat # PAB30760) (Green) shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human AK1.
Immunogen
Recombinant protein corresponding to human AK1.
Sequence
EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with AK1 polyclonal antibody (Cat # PAB30760).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human thyroid gland with AK1 polyclonal antibody (Cat # PAB30760) shows strong cytoplasmic and nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with AK1 polyclonal antibody (Cat # PAB30760) (Green) shows positivity in cytoplasm. -
Gene Info — AK1
Entrez GeneID
203Protein Accession#
P00568Gene Name
AK1
Gene Alias
-
Gene Description
adenylate kinase 1
Omim ID
103000Gene Ontology
HyperlinkGene Summary
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|OTTHUMP00000022217|OTTHUMP00000022218|myokinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com