SYVN1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SYVN1 polyclonal antibody (Cat # PAB30736).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with SYVN1 polyclonal antibody (Cat # PAB30736) shows strong cytoplasmic positivity in exocrine glandular cells
Immunofluorescence
Immunofluorescent staining of A-431 cells with SYVN1 polyclonal antibody (Cat # PAB30736) (Green) shows positivity in endoplasmic reticulum and nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human SYVN1.
Immunogen
Recombinant protein corresponding to human SYVN1.
Sequence
PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SYVN1 polyclonal antibody (Cat # PAB30736).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with SYVN1 polyclonal antibody (Cat # PAB30736) shows strong cytoplasmic positivity in exocrine glandular cellsImmunofluorescence
Immunofluorescent staining of A-431 cells with SYVN1 polyclonal antibody (Cat # PAB30736) (Green) shows positivity in endoplasmic reticulum and nucleus but excluded from the nucleoli. -
Gene Info — SYVN1
Entrez GeneID
84447Protein Accession#
Q86TM6Gene Name
SYVN1
Gene Alias
HRD1, KIAA1810, MGC40372
Gene Description
synovial apoptosis inhibitor 1, synoviolin
Omim ID
608046Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. This gene and the mitochondrial ribosomal protein L49 gene use in their respective 3' UTRs some of the same genomic sequence. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq
Other Designations
synoviolin 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com