ARID1A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ARID1A.
Immunogen
Recombinant protein corresponding to human ARID1A.
Sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human nasopharynx with ARID1A polyclonal antibody (Cat # PAB30731) shows strong nuclear positivity.Immunofluorescence
Immunofluorescent staining of U-2 OS with ARID1A polyclonal antibody (Cat # PAB30731) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — ARID1A
Entrez GeneID
8289Protein Accession#
O14497Gene Name
ARID1A
Gene Alias
B120, BAF250, BAF250a, BM029, C1orf4, P270, SMARCF1
Gene Description
AT rich interactive domain 1A (SWI-like)
Omim ID
603024Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
AT rich interactive domain 1A|AT rich interactive domain 1A (SWI- like)|BRG1-associated factor 250a|OSA1 nuclear protein|OTTHUMP00000004117|OTTHUMP00000044975|SWI/SNF complex protein p270|SWI/SNF related, matrix associated, actin dependent regulator of ch
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com