Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARID3A polyclonal antibody

  • Catalog # : PAB30709
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ARID3A.
  • Immunogen:
  • Recombinant protein corresponding to human ARID3A.
  • Sequence:
  • FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ARID3A polyclonal antibody (Cat # PAB30709) shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS with ARID3A polyclonal antibody (Cat # PAB30709) (Green) shows positivity in cytoplasm, the Golgi apparatus and nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1820
  • Gene Name:
  • ARID3A
  • Gene Alias:
  • BRIGHT,DRIL1,DRIL3,E2FBP1
  • Gene Description:
  • AT rich interactive domain 3A (BRIGHT-like)
  • Gene Summary:
  • This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq
  • Other Designations:
  • ARID domain-containing 3A,AT rich interactive domain 3A (BRIGHT- like),AT rich interactive domain 3A (BRIGHT- like) protein,B-cell regulator of IgH transcription,E2F-binding protein 1,dead ringer-like 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook