MCM3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against partial recombinant human MCM3.
Immunogen
Recombinant protein corresponding to human MCM3.
Sequence
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with MCM3 polyclonal antibody (Cat # PAB30707).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with MCM3 polyclonal antibody (Cat # PAB30707) shows strong nuclear positivity in reaction center cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with MCM3 polyclonal antibody (Cat # PAB30707) (Green) shows positivity in vesicles and nucleus but excluded from the nucleoli. -
Gene Info — MCM3
Entrez GeneID
4172Protein Accession#
P25205Gene Name
MCM3
Gene Alias
HCC5, MGC1157, P1-MCM3, P1.h, RLFB
Gene Description
minichromosome maintenance complex component 3
Omim ID
602693Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
Other Designations
DNA polymerase alpha holoenzyme-associated protein P1|DNA replication factor MCM3|MCM3 minichromosome maintenance deficient 3|OTTHUMP00000016600|cervical cancer proto-oncogene 5|hRlf beta subunit|minichromosome maintenance deficient 3|replication licensin
-
Interactomes
-
Pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com