AKAP8 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with AKAP8 polyclonal antibody (Cat # PAB30706).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with AKAP8 polyclonal antibody (Cat # PAB30706) shows strong nuclear positivity in exocrine glandular cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with AKAP8 polyclonal antibody (Cat # PAB30706) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human AKAP8.
Immunogen
Recombinant protein corresponding to human AKAP8.
Sequence
PEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with AKAP8 polyclonal antibody (Cat # PAB30706).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with AKAP8 polyclonal antibody (Cat # PAB30706) shows strong nuclear positivity in exocrine glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with AKAP8 polyclonal antibody (Cat # PAB30706) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — AKAP8
Entrez GeneID
10270Protein Accession#
O43823Gene Name
AKAP8
Gene Alias
AKAP95, DKFZp586B1222
Gene Description
A kinase (PRKA) anchor protein 8
Omim ID
604692Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA. [provided by RefSeq
Other Designations
A-kinase anchor protein 8|A-kinase anchor protein, 95kDa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com