ILKAP polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ILKAP polyclonal antibody (Cat # PAB30705).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with ILKAP polyclonal antibody (Cat # PAB30705) shows strong nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with ILKAP polyclonal antibody (Cat # PAB30705) (Green) shows positivity in nucleus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ILKAP.
Immunogen
Recombinant protein corresponding to human ILKAP.
Sequence
PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ILKAP polyclonal antibody (Cat # PAB30705).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with ILKAP polyclonal antibody (Cat # PAB30705) shows strong nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with ILKAP polyclonal antibody (Cat # PAB30705) (Green) shows positivity in nucleus. -
Gene Info — ILKAP
Entrez GeneID
80895Protein Accession#
Q9H0C8Gene Name
ILKAP
Gene Alias
DKFZp434J2031, FLJ10181, MGC4846, PP2C-DELTA
Gene Description
integrin-linked kinase-associated serine/threonine phosphatase 2C
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq
Other Designations
integrin-linked kinase-associated protein phosphatase 2C|protein phosphatase 2c, delta isozyme
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com