Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARHGAP1 polyclonal antibody

  • Catalog # : PAB30697
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ARHGAP1.
  • Immunogen:
  • Recombinant protein corresponding to human ARHGAP1.
  • Sequence:
  • SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of mouse cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ARHGAP1 polyclonal antibody (Cat # PAB30697).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human stomach (C) with ARHGAP1 polyclonal antibody (Cat # PAB30697). A: Human hippocampus shows positivity in neuropil. B: Human hippocampus shows weak immunoreactivity in neuropil. C: Human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG (A), mouse dentate gyrus (B), mouse cingulate cortex (C), mouse thalamus (D), mouse motor trigeminal nucleus (E) and mouse brain (F) with ARHGAP1 polyclonal antibody (Cat # PAB30697) (Green). A: U-251 MG shows positivity in vesicles. B: Mouse dentate gyrus shows immunoreactivity in polymorph layer. C: Mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons. D: Mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus. E: Mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes. F: Mouse brain shows neuronal staining in lateral paragigantocellular nucleus.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 392
  • Gene Name:
  • ARHGAP1
  • Gene Alias:
  • CDC42GAP,RHOGAP,RHOGAP1,p50rhoGAP
  • Gene Description:
  • Rho GTPase activating protein 1
  • Other Designations:
  • CDC42 GTPase-activating protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook