ARHGAP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).
Western Blot (Tissue lysate)
Western Blot analysis of mouse cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ARHGAP1 polyclonal antibody (Cat # PAB30697).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human stomach (C) with ARHGAP1 polyclonal antibody (Cat # PAB30697). A: Human hippocampus shows positivity in neuropil. B: Human hippocampus shows weak immunoreactivity in neuropil. C: Human stomach shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG (A), mouse dentate gyrus (B), mouse cingulate cortex (C), mouse thalamus (D), mouse motor trigeminal nucleus (E) and mouse brain (F) with ARHGAP1 polyclonal antibody (Cat # PAB30697) (Green). A: U-251 MG shows positivity in vesicles. B: Mouse dentate gyrus shows immunoreactivity in polymorph layer. C: Mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons. D: Mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus. E: Mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes. F: Mouse brain shows neuronal staining in lateral paragigantocellular nucleus.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ARHGAP1.
Immunogen
Recombinant protein corresponding to human ARHGAP1.
Sequence
SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).Western Blot (Tissue lysate)
Western Blot analysis of mouse cerebral cortex tissue lysate with ARHGAP1 polyclonal antibody (Cat # PAB30697).Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ARHGAP1 polyclonal antibody (Cat # PAB30697).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus (A, B), human stomach (C) with ARHGAP1 polyclonal antibody (Cat # PAB30697). A: Human hippocampus shows positivity in neuropil. B: Human hippocampus shows weak immunoreactivity in neuropil. C: Human stomach shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG (A), mouse dentate gyrus (B), mouse cingulate cortex (C), mouse thalamus (D), mouse motor trigeminal nucleus (E) and mouse brain (F) with ARHGAP1 polyclonal antibody (Cat # PAB30697) (Green). A: U-251 MG shows positivity in vesicles. B: Mouse dentate gyrus shows immunoreactivity in polymorph layer. C: Mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons. D: Mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus. E: Mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes. F: Mouse brain shows neuronal staining in lateral paragigantocellular nucleus. -
Gene Info — ARHGAP1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com