DAZAP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DAZAP1.
Immunogen
Recombinant protein corresponding to human DAZAP1.
Sequence
EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with DAZAP1 polyclonal antibody (Cat # PAB30686).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with DAZAP1 polyclonal antibody (Cat # PAB30686) shows strong nuclear positivity in cells of seminiferous ducts.Immunofluorescence
Immunofluorescent staining of U-251 MG with DAZAP1 polyclonal antibody (Cat # PAB30686) (Green) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. -
Gene Info — DAZAP1
Entrez GeneID
26528Protein Accession#
Q96EP5Gene Name
DAZAP1
Gene Alias
MGC19907
Gene Description
DAZ associated protein 1
Omim ID
607430Gene Ontology
HyperlinkGene Summary
In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
deleted in azoospermia associated protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com