RBM23 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with RBM23 polyclonal antibody (Cat # PAB30676).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with RBM23 polyclonal antibody (Cat # PAB30676) shows moderate cytoplasmic positivity in cortical cells.
Immunofluorescence
Immunofluorescent staining of U-2 OS with RBM23 polyclonal antibody (Cat # PAB30676) (Green) shows positivity in intermediate filaments.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human RBM23.
Immunogen
Recombinant protein corresponding to human RBM23.
Sequence
MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with RBM23 polyclonal antibody (Cat # PAB30676).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with RBM23 polyclonal antibody (Cat # PAB30676) shows moderate cytoplasmic positivity in cortical cells.Immunofluorescence
Immunofluorescent staining of U-2 OS with RBM23 polyclonal antibody (Cat # PAB30676) (Green) shows positivity in intermediate filaments. -
Gene Info — RBM23
Entrez GeneID
55147Protein Accession#
Q86U06Gene Name
RBM23
Gene Alias
CAPERbeta, FLJ10482, MGC4458, PP239, RNPC4
Gene Description
RNA binding motif protein 23
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
RNA-binding region (RNP1, RRM) containing 4|splicing factor SF2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com