Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MARS polyclonal antibody

  • Catalog # : PAB30671
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human MARS.
  • Immunogen:
  • Recombinant protein corresponding to human MARS.
  • Sequence:
  • FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with MARS polyclonal antibody (Cat # PAB30671).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex (A, B), human small intestine (C) with MARS polyclonal antibody (Cat # PAB30671). A: Human cerebral cortex shows cytoplasmic positivity in subsets of neurons. B: Human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies. C: Human small intestine shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-2 OS (A), mouse cerebellum (B), mouse olfactory bulb (C), mouse visual cortex (D), mouse cerebral peduncle (E) and mouse pons (F) with MARS polyclonal antibody (Cat # PAB30671) (Green). A: U-2 OS shows positivity in cytoplasm. B: Mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells. C: Mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons. D: Mouse visual cortex shows cytoplasmic and axonal staining in neurons. E: Mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons. F: Mouse pons shows neuronal positivity in motor trigeminal nucleus.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4141
  • Gene Name:
  • MARS
  • Gene Alias:
  • FLJ35667,METRS,MTRNS
  • Gene Description:
  • methionyl-tRNA synthetase
  • Gene Summary:
  • Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases. [provided by RefSeq
  • Other Designations:
  • methionine tRNA ligase 1, cytoplasmic,methionine-tRNA synthetase
  • RSS
  • YouTube
  • Linkedin
  • Facebook