G3BP1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with G3BP1 polyclonal antibody (Cat # PAB30666).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with G3BP1 polyclonal antibody (Cat # PAB30666) shows strong cytoplasmic positivity in germinal center cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with G3BP1 polyclonal antibody (Cat # PAB30666) (Green) shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human G3BP1.
Immunogen
Recombinant protein corresponding to human G3BP1.
Sequence
FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with G3BP1 polyclonal antibody (Cat # PAB30666).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with G3BP1 polyclonal antibody (Cat # PAB30666) shows strong cytoplasmic positivity in germinal center cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with G3BP1 polyclonal antibody (Cat # PAB30666) (Green) shows positivity in cytoplasm. -
Gene Info — G3BP1
Entrez GeneID
10146Protein Accession#
Q13283Gene Name
G3BP1
Gene Alias
G3BP, HDH-VIII, MGC111040
Gene Description
GTPase activating protein (SH3 domain) binding protein 1
Omim ID
608431Gene Ontology
HyperlinkGene Summary
This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
GAP binding protein|OTTHUMP00000160618|Ras-GTPase-activating protein SH3-domain-binding protein|RasGAP-associated endoribonuclease G3BP
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com