BCAP31 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with BCAP31 polyclonal antibody (Cat # PAB30653).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with BCAP31 polyclonal antibody (Cat # PAB30653) shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunofluorescence
Immunofluorescent staining of U-2 OS with BCAP31 polyclonal antibody (Cat # PAB30653) (Green) shows positivity in endoplasmic reticulum.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human BCAP31.
Immunogen
Recombinant protein corresponding to human BCAP31.
Sequence
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with BCAP31 polyclonal antibody (Cat # PAB30653).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with BCAP31 polyclonal antibody (Cat # PAB30653) shows strong cytoplasmic positivity in cells in seminiferous ducts.Immunofluorescence
Immunofluorescent staining of U-2 OS with BCAP31 polyclonal antibody (Cat # PAB30653) (Green) shows positivity in endoplasmic reticulum. -
Gene Info — BCAP31
Entrez GeneID
10134Protein Accession#
P51572Gene Name
BCAP31
Gene Alias
6C6-AG, BAP31, CDM, DXS1357E
Gene Description
B-cell receptor-associated protein 31
Omim ID
300398Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. Two pseudogenes have been identified on chromosome 16. Alternatively spliced transcript variants encoding distinct isoforms have been described although the biological validity of some of the variants has not been determined. [provided by RefSeq
Other Designations
6C6 antigen|BCR-associated protein Bap31|OTTHUMP00000025977|OTTHUMP00000025978|p28 Bap31
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com