Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNAL4 polyclonal antibody

  • Catalog # : PAB30638
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human DNAL4.
  • Immunogen:
  • Recombinant protein corresponding to human DNAL4.
  • Sequence:
  • MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with DNAL4 polyclonal antibody (Cat # PAB30638).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bronchus with DNAL4 polyclonal antibody (Cat # PAB30638) shows moderate positivity in cilia of respiratory epithelial cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 MG with DNAL4 polyclonal antibody (Cat # PAB30638) (Green) shows positivity in centrosome.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • DNAL4
  • Gene Alias:
  • PIG27
  • Gene Description:
  • dynein, axonemal, light chain 4
  • Gene Summary:
  • DNAL4 is a component of the dynein motor complex (Iwasaki et al., 2005 [PubMed 15454493]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000028665,dynein light chain 4, axonemal,dynein light chain, outer arm 4,dynein, axonemal, light 4,dynein, axonemal, light polypeptide 4,proliferation-inducing gene 27,proliferation-inducing protein 27
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook