TIMM8A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with TIMM8A polyclonal antibody (Cat # PAB30636).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with TIMM8A polyclonal antibody (Cat # PAB30636) shows strong cytoplasmic positivity in hepatocytes.
Immunofluorescence
Immunofluorescent staining of U-2 OS with TIMM8A polyclonal antibody (Cat # PAB30636) (Green) shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TIMM8A.
Immunogen
Recombinant protein corresponding to human TIMM8A.
Sequence
GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with TIMM8A polyclonal antibody (Cat # PAB30636).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with TIMM8A polyclonal antibody (Cat # PAB30636) shows strong cytoplasmic positivity in hepatocytes.Immunofluorescence
Immunofluorescent staining of U-2 OS with TIMM8A polyclonal antibody (Cat # PAB30636) (Green) shows positivity in mitochondria. -
Gene Info — TIMM8A
Entrez GeneID
1678Protein Accession#
O60220Gene Name
TIMM8A
Gene Alias
DDP, DDP1, DFN1, MGC12262, MTS
Gene Description
translocase of inner mitochondrial membrane 8 homolog A (yeast)
Gene Ontology
HyperlinkGene Summary
This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms
Other Designations
OTTHUMP00000023681|deafness/dystonia peptide|translocase of inner mitochondrial membrane 8 homolog A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com