Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CUX1 polyclonal antibody

  • Catalog # : PAB30618
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human CUX1.
  • Immunogen:
  • Recombinant protein corresponding to human CUX1.
  • Sequence:
  • KSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp and Lane 3: human plasma (IgG/HSA depleted) with CUX1 polyclonal antibody (Cat # PAB30618).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach, upper with CUX1 polyclonal antibody (Cat # PAB30618) shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of MCF7 cells with CUX1 polyclonal antibody (Cat # PAB30618) (Green) shows positivity in the Golgi apparatus and nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1523
  • Gene Name:
  • CUX1
  • Gene Alias:
  • CASP,CDP,CDP/Cut,CDP1,COY1,CUTL1,CUX,Clox,Cux/CDP,GOLIM6,Nbla10317,p100,p110,p200,p75
  • Gene Description:
  • cut-like homeobox 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • cut homeobox,cut homolog,cut-like 1, CCAAT displacement protein,golgi integral membrane protein 6,putative protein product of Nbla10317
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook