Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASB7 polyclonal antibody

  • Catalog # : PAB30617
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ASB7.
  • Immunogen:
  • Recombinant protein corresponding to human ASB7.
  • Sequence:
  • HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ASB7 polyclonal antibody (Cat # PAB30617).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with ASB7 polyclonal antibody (Cat # PAB30617) shows moderate cytoplasmic positivity in urothelial cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-431 cells with ASB7 polyclonal antibody (Cat # PAB30617) (Green) shows positivity in cytoplasm and the Golgi apparatus.
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • ASB7
  • Gene Alias:
  • FLJ22551
  • Gene Description:
  • ankyrin repeat and SOCS box-containing 7
  • Gene Summary:
  • The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • ankyrin repeat and SOCS box-containing protein 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook