Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NR4A2 polyclonal antibody

  • Catalog # : PAB30608
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human NR4A2.
  • Immunogen:
  • Recombinant protein corresponding to human NR4A2.
  • Sequence:
  • VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with NR4A2 polyclonal antibody (Cat # PAB30608) shows moderate membranous and nuclear positivity in cells in tubules.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of SiHa cells with NR4A2 polyclonal antibody (Cat # PAB30608) (Green) shows positivity in nucleus but excluded from the nucleoli.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4929
  • Gene Name:
  • NR4A2
  • Gene Alias:
  • HZF-3,NOT,NURR1,RNR1,TINUR
  • Gene Description:
  • nuclear receptor subfamily 4, group A, member 2
  • Gene Summary:
  • This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • NGFI-B/nur77 beta-type transcription factor homolog,T-cell nuclear receptor NOT,intermediate-early receptor protein,nur related protein-1, human homolog of,orphan nuclear receptor NURR1,transcriptionally inducible nuclear receptor related 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook