TOMM70A polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with TOMM70A polyclonal antibody (Cat # PAB30601).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with TOMM70A polyclonal antibody (Cat # PAB30601).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human celebellum with TOMM70A polyclonal antibody (Cat # PAB30601) shows strong cytoplasmic positivity in Purkinje cells, cells in the granular and molecular layer.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TOMM70A polyclonal antibody (Cat # PAB30601) shows positivity in mitochondria. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TOMM70A.
Immunogen
Recombinant protein corresponding to amino acids 383-512 of human TOMM70A.
Sequence
PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with TOMM70A polyclonal antibody (Cat # PAB30601).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with TOMM70A polyclonal antibody (Cat # PAB30601).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human celebellum with TOMM70A polyclonal antibody (Cat # PAB30601) shows strong cytoplasmic positivity in Purkinje cells, cells in the granular and molecular layer.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TOMM70A polyclonal antibody (Cat # PAB30601) shows positivity in mitochondria. Antibody staining is shown in green. -
Gene Info — TOMM70A
Entrez GeneID
9868Protein Accession#
O94826Gene Name
TOMM70A
Gene Alias
FLJ90470
Gene Description
translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
Omim ID
606081Gene Ontology
HyperlinkGene Summary
The translocase of outer mitochondrial membrane (TOM) complex is a multisubunit complex involved in the recognition, unfolding, and translocation of preproteins into the mitochondria. See TIM17A (MIM 605057).[supplied by OMIM
Other Designations
translocase of outer mitochondrial membrane 70 homolog A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com