TSPAN9 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis with TSPAN9 polyclonal antibody (Cat # PAB30598).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with TSPAN9 polyclonal antibody (Cat # PAB30598) shows moderate positivity in intercalated discs.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with TSPAN9 polyclonal antibody (Cat # PAB30598) shows positivity in cytoplasm, the Golgi apparatus and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human TSPAN9.
Immunogen
Recombinant protein corresponding to amino acids 123-200 of human TSPAN9.
Sequence
LLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDD
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis with TSPAN9 polyclonal antibody (Cat # PAB30598).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with TSPAN9 polyclonal antibody (Cat # PAB30598) shows moderate positivity in intercalated discs.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with TSPAN9 polyclonal antibody (Cat # PAB30598) shows positivity in cytoplasm, the Golgi apparatus and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — TSPAN9
Entrez GeneID
10867Protein Accession#
O75954Gene Name
TSPAN9
Gene Alias
NET-5, PP1057
Gene Description
tetraspanin 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq
Other Designations
transmembrane 4 superfamily member tetraspan NET-5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com