MAP2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP2 polyclonal antibody (Cat # PAB30594).
A: Showing positivity in subsets of neurons and processes.
B: Showing strong cytoplasmic immunoreactivity in neurons, as well as positivity in neuropil.
C: Showing strong cytoplasmic and nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with MAP2 polyclonal antibody (Cat # PAB30594) shows cytoplasmic positivity in Purkinje cells and molecular layer neurons.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human MAP2.
Immunogen
Recombinant protein corresponding to amino acids 8-148 of human MAP2.
Sequence
EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP2 polyclonal antibody (Cat # PAB30594).
A: Showing positivity in subsets of neurons and processes.
B: Showing strong cytoplasmic immunoreactivity in neurons, as well as positivity in neuropil.
C: Showing strong cytoplasmic and nuclear positivity in neuronal cells and glial cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with MAP2 polyclonal antibody (Cat # PAB30594) shows cytoplasmic positivity in Purkinje cells and molecular layer neurons. -
Gene Info — MAP2
Entrez GeneID
4133Protein Accession#
P11137Gene Name
MAP2
Gene Alias
DKFZp686I2148, MAP2A, MAP2B, MAP2C
Gene Description
microtubule-associated protein 2
Omim ID
157130Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000163916
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com