Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP2 polyclonal antibody

  • Catalog # : PAB30594
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human MAP2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 8-148 of human MAP2.
  • Sequence:
  • EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1 - 4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP2 polyclonal antibody (Cat # PAB30594).
    A: Showing positivity in subsets of neurons and processes.
    B: Showing strong cytoplasmic immunoreactivity in neurons, as well as positivity in neuropil.
    C: Showing strong cytoplasmic and nuclear positivity in neuronal cells and glial cells.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with MAP2 polyclonal antibody (Cat # PAB30594) shows cytoplasmic positivity in Purkinje cells and molecular layer neurons.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with MAP2 polyclonal antibody (Cat # PAB30594) shows positivity in nucleoli and cytoplasm. Antibody staining is shown in green.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining with MAP2 polyclonal antibody (Cat # PAB30594).
    A: Immunofluorescence staining of mouse cerebral cortex shows immunoreactivity in neurons and dendrites.
    B: Immunofluorescence staining of mouse lateral septum shows immunoreactivity in neurons and processes.
    C: Immunofluorescence staining of mouse globus pallidus shows immunoreactivity in dense network of dendrites.
    D: Immunofluorescence staining of mouse hippocampus shows selective immunoreactivity in the CA1 area.
    E: Immunofluorescence staining of mouse facial nucleus shows strong positivity in neuronal cell bodies and processes.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4133
  • Gene Name:
  • MAP2
  • Gene Alias:
  • DKFZp686I2148,MAP2A,MAP2B,MAP2C
  • Gene Description:
  • microtubule-associated protein 2
  • Gene Summary:
  • This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000163916
  • RSS
  • YouTube
  • Linkedin
  • Facebook