NUDT1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis with NUDT1 polyclonal antibody (Cat # PAB30591).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with NUDT1 polyclonal antibody (Cat # PAB30591) shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with NUDT1 polyclonal antibody (Cat # PAB30591) shows positivity in cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human NUDT1.
Immunogen
Recombinant protein corresponding to amino acids 72-191 of human NUDT1.
Sequence
RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis with NUDT1 polyclonal antibody (Cat # PAB30591).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with NUDT1 polyclonal antibody (Cat # PAB30591) shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with NUDT1 polyclonal antibody (Cat # PAB30591) shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — NUDT1
Entrez GeneID
4521Protein Accession#
P36639Gene Name
NUDT1
Gene Alias
MTH1
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 1
Omim ID
600312Gene Ontology
HyperlinkGene Summary
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq
Other Designations
7,8-dihydro-8-oxoguanine triphosphatase|8-oxo-7,8-dihydrodeoxyguanosine triphosphatase|8-oxo-7,8-dihydroguanosine triphosphatase|8-oxo-dGTPase|OTTHUMP00000024690|OTTHUMP00000115537|OTTHUMP00000115538|OTTHUMP00000115539|OTTHUMP00000115540|mutT human homolo
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com